PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB
Protein Properties Length: 340aa    MW: 38471.6 Da    PI: 7.177
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014141genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l+  ++ +G g+W++ ++  g +R++k+c++rw +yl
        Cla014141 14 KGPWSPEEDQKLITHIQNHGQGNWRSLPKLAGINRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding56.66.1e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e++++++  lG++ W++Iar ++ gRt++++k++w++++
        Cla014141  67 RGKFTREEEEIILNLHSILGNK-WSAIARQLP-GRTDNEIKNFWNTHM 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.537961IPR017930Myb domain
SuperFamilySSF466896.36E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
CDDcd001672.46E-111661No hitNo description
PROSITE profilePS5129427.51862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2765117IPR009057Homeodomain-like
SMARTSM007178.5E-1766114IPR001005SANT/Myb domain
PfamPF002491.7E-1567111IPR001005SANT/Myb domain
CDDcd001673.79E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRSPCCDGS PLKKGPWSPE EDQKLITHIQ NHGQGNWRSL PKLAGINRCG KSCRLRWINY  60
LRPDIKRGKF TREEEEIILN LHSILGNKWS AIARQLPGRT DNEIKNFWNT HMKRKLIEMG  120
FDPMTHRPQT NITWSLAHII GLATLKQLMN NPLWEEHPQI LQYLDQYHLL QPPSLTNIIN  180
SINPTEIEIM SLINSLSSPL FQNRMIMTQN YTNDNNNNPL PSLGTDSVGL SLSHLPSLEI  240
IPNNTNIYET TPFNVKEMCV VQNNEVCDTN NSPWQLPSSS TAASPPHRNI NHDGPSSNTN  300
NCGDACSSSS FVGSSACIWP DHLLLEHSFL HNTPLLPPWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143558.11e-156PREDICTED: myb-related protein Hv1
TrEMBLA0A0A0KLW51e-128A0A0A0KLW5_CUCSA; Uncharacterized protein
STRINGVIT_07s0141g00100.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.12e-85myb domain protein 92